PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.006G005500.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family NF-YB
Protein Properties Length: 215aa    MW: 23236.9 Da    PI: 5.7651
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.006G005500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB177.71.1e-5555150297
               NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyre 92 
                         reqd++lPianvsrimkk+lPanakiskd ketvqecvsefisf+t+easdkcqrekrkt+ngddllwa++tlGfedy+eplk+yl+k+re
  Potri.006G005500.1  55 REQDKLLPIANVSRIMKKALPANAKISKDGKETVQECVSEFISFITGEASDKCQREKRKTVNGDDLLWAMTTLGFEDYAEPLKIYLQKFRE 145
                         89***************************************************************************************** PP

               NF-YB  93 legek 97 
                         +ege+
  Potri.006G005500.1 146 TEGER 150
                         ***97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.7E-5250161IPR009072Histone-fold
SuperFamilySSF471132.79E-3857159IPR009072Histone-fold
PfamPF008086.3E-2661124IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006154.3E-2188106No hitNo description
PROSITE patternPS00685091107IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006154.3E-21107125No hitNo description
PRINTSPR006154.3E-21126144No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 215 aa     Download sequence    Send to blast
MYGPKQTISI SISISIYIYI KESQAQESLG FMADSDNESG GQNNSNTNYS ETSSREQDKL  60
LPIANVSRIM KKALPANAKI SKDGKETVQE CVSEFISFIT GEASDKCQRE KRKTVNGDDL  120
LWAMTTLGFE DYAEPLKIYL QKFRETEGER TAAMGTVRQG DQRDGAVVNS GDSGGGFGGS  180
GGNVYGGMQS SMMMMGHHPL HQGNMYGSAS GRPK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B1e-4755145292Transcription factor HapC (Eurofung)
4g92_B1e-4755145292Transcription factor HapC (Eurofung)
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.125150.0bud| catkin
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2101291e-146AC210129.1 Populus trichocarpa clone POP009-F11, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002308762.21e-135hypothetical protein POPTR_0006s00730g
SwissprotO233103e-71NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBLB9HCC91e-135B9HCC9_POPTR; Uncharacterized protein
STRINGPOPTR_0006s00730.11e-135(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59134150
Representative plantOGRP16817170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.14e-70nuclear factor Y, subunit B3